SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162448335|ref|YP_001610702.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162448335|ref|YP_001610702.1|
Domain Number 1 Region: 2-171,262-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-62
Family FAD-linked reductases, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 405-535
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000136
Family Glutathione peroxidase-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162448335|ref|YP_001610702.1|
Sequence length 540
Comment pentachlorophenol monooxygenase [Sorangium cellulosum So ce56]
Sequence
MVVGGGPTGLTMAGELARRGLAVRIVDKALEPPPDHSRALVVQTRTMEIFTSMGIADAAM
ARATRVGGLNVLLSNGQRARLPIFDFPELSTPVPGIFVIQQFDTERVLGSRLSELGVTVE
RGAELASYTQDSAGVTCTLRRVDGNTEVVRAKWLLGCDGARSAVRQGVDIAFEGDTYDDH
CMLGDLVIDWPLPDGDIYISPSRRGLAAAFPVPGSHRFRIVLILPEASPARGASLSLEVF
EGVMRSMIPTPFKIQKAIVLSRYRLHHRVATRLRKGRVFLAGDAAHIHSPAGGQGMNTGI
QDAYNLAWKLAAVEQGRMPAWLLDTYEMERLPVARRLIDFTDRLFGLMAGHGLMGRALRI
VAPRLMIRAIGVAAVQRRILGFISQLKIRYRKSPLSIQIGHPPERGPRAGDRAPDASLLS
AAGQQVHLFELMRGVESTLLLFAGPPGPPHASANTEAHRHARRLAAELGRPDLKVLVISA
PEAGGYADPDGRAHAAYGVEAAAAVLVRPDGYVGVRCDPLDERELRQALDRLFTRRADAA
Download sequence
Identical sequences A9GL40
gi|162448335|ref|YP_001610702.1| WP_012232700.1.90317 448385.sce0066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]