SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162448453|ref|YP_001610820.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162448453|ref|YP_001610820.1|
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000179
Family Glutathione S-transferase (GST), N-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  gi|162448453|ref|YP_001610820.1|
Domain Number - Region: 193-245
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0377
Family Glutathione S-transferase (GST), C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162448453|ref|YP_001610820.1|
Sequence length 251
Comment hypothetical protein sce0183 [Sorangium cellulosum So ce56]
Sequence
MTELLGLVFSPWTEKARWALDVRRVPYTFRHYQPLVGEPALRVKLRRLTGRVSVPVLTTD
DGRVLGDSADIARWADGRGAGPTLFPVEHEADIARLIDLSERGLAAGRARALRRMLADDE
ALAEMAPRPIRRALAPLASRLGALGVARTLRKYEGDKADGEAHRQTQVAVLEEIRETLAR
AAPPGDAPRTLLGRFTFADIAMSQVLVNVAPPAQLKLGAASRRCFSDPDLRDRYDDLIAW
RDELYRAFRTS
Download sequence
Identical sequences A9GLX2
448385.sce0183 gi|162448453|ref|YP_001610820.1| WP_012232818.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]