SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162448891|ref|YP_001611258.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162448891|ref|YP_001611258.1|
Domain Number 1 Region: 148-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000609
Family Thioltransferase 0.0072
Further Details:      
 
Weak hits

Sequence:  gi|162448891|ref|YP_001611258.1|
Domain Number - Region: 43-115
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000103
Family HMA, heavy metal-associated domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162448891|ref|YP_001611258.1|
Sequence length 245
Comment hypothetical protein sce0621 [Sorangium cellulosum So ce56]
Sequence
MRSANALSSALGLTAFSGWLAARGGWLVAFGSLAAACGGVQPVPEGASTTVVSLRKIDCE
ACGAELVADLRERPGVYSAAFDRRRAEISVTASRSFDVAGTVKRLAADEGFEAVLGAGHG
QYLGWATFPEGADARTIEDGGADIPDLGAQIVPGKVTVIDFVAAWCMPCRKLDAHMVTVL
EARKDVAYRKLDIVDWDSPLARRYLKQVSKLPYVIVFDTSGARVEAIAGLALDELDAAIE
RGARR
Download sequence
Identical sequences A9GVM5
448385.sce0621 WP_012233256.1.90317 gi|162448891|ref|YP_001611258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]