SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162449519|ref|YP_001611886.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162449519|ref|YP_001611886.1|
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 70-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000313
Family Glutathione S-transferase (GST), C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162449519|ref|YP_001611886.1|
Sequence length 210
Comment hypothetical protein sce1249 [Sorangium cellulosum So ce56]
Sequence
MILIGQYDSPFVRRVAVALQHYGLAYEHRPWSVWADAESIAKYNPLRRVPVLVTDGGEPL
VESAAILDALDDLVGPDRALLPRSGEARRAGLRVSALATGLADKAVSLLYEHVLRTGERR
SPVWVERCTAQIGETLDLLERERAARRGDAFWLGAFSHADIAVACALRFTSEAHPALTDA
ARRPALAAHAARCEALPVFAAVVQPLHVAV
Download sequence
Identical sequences A9F669
WP_012233883.1.90317 gi|162449519|ref|YP_001611886.1| 448385.sce1249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]