SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162449598|ref|YP_001611965.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162449598|ref|YP_001611965.1|
Domain Number 1 Region: 35-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-30
Family Thioltransferase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162449598|ref|YP_001611965.1|
Sequence length 152
Comment thioredoxin [Sorangium cellulosum So ce56]
Sequence
MAIYRCGRCGSINRVADQRVKDRPVCGRCKAHLDTTGAPQPVDGAALEQAIASSPVPVLV
DYWATWCGPCRVVAPALDELGRRNAGKVLVLKLDTDADPAEAGRRRIQGVPTFVLFSGGR
ELDRRSGVTSRADLERWIEARAGQPSTRASHA
Download sequence
Identical sequences A9F6Z3
448385.sce1327 WP_012233962.1.90317 gi|162449598|ref|YP_001611965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]