SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162450578|ref|YP_001612945.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162450578|ref|YP_001612945.1|
Domain Number 1 Region: 97-154
Classification Level Classification E-value
Superfamily BPTI-like 1.14e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162450578|ref|YP_001612945.1|
Sequence length 318
Comment hypothetical protein sce2306 [Sorangium cellulosum So ce56]
Sequence
MQLLRSIVLCARDRRRADCNVFGNYQRLSLGLGLLTSLMLAAGCSGAGNDGGSGGGGPGG
GGPGGGGPVAGSGGGSSSSVAGSGGGSAASSGAGGESPDRCALPQETGPCDAAIPSYWHD
PGTGECVPFIYGGCEGNANRFESLAACLETCQGTTTDMDACAAPGDCVLAPPRCCASCDP
VDASAFVALHRDAVADFWNASGCGDTQCERCPEVGEAESTSQYFAATCESGRCVVVDVRE
SPLTECTKDADCALRDGVGCCESCDGKGIVALNQSGDLGALVCPEEIVACPPCAPVYPEG
MTAVCSEGRCTPRLSETP
Download sequence
Identical sequences A9G127
448385.sce2306 WP_012234938.1.90317 gi|162450578|ref|YP_001612945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]