SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162450797|ref|YP_001613164.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162450797|ref|YP_001613164.1|
Domain Number 1 Region: 195-573
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.5e-64
Family Cellulases catalytic domain 0.049
Further Details:      
 
Domain Number 2 Region: 4-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.54e-32
Family Thioltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162450797|ref|YP_001613164.1|
Sequence length 716
Comment hypothetical protein sce2525 [Sorangium cellulosum So ce56]
Sequence
MAAHKNRLASESSPYLLQHAHNPVAWYPWGAEALDLARREDKPILLSIGYAACHWCHVME
RESFEDEAIARHMNDLFVNIKVDREERPDLDHIYQLVVQLMGRSGGWPLTVFLTPDQRPF
FAGTYFPPKDALGMPGFPKVLDKIADAFRNRRDDVEQQAQEITEAIERAQRAPARAAGVA
APASSDLLRRASRQLLARLDPRHGGIGSRPKFPNTMALDVLLRRGVLESDRVAAEGVELT
LDRMRDGGIWDHLRGGFHRYSTDERWLVPHFEKMLYDNALLLRLYADGFRAFKKPIYAET
AREIVGYLFAEMRDPEGGFYASQDADSEGREGKFFVWTLEQLRDAVGEDQLAYDMARLVF
GISEEGNFEDSGATVLSQHRTLEQAAAVIDDGAGGGPSTHLDRCRDALARARVAMLAARD
ARPRPARDDKVLASWNGLLIGALADAGRALDEPAWVDAAARAFALLERKLLRGGRVGRYL
KDGAPAGANREHGGSGAAVGDVRPGFLDDQAYLGNAALDLYEATSDPRYVDVARAIADAM
IAHHWDEAAPGFFFTPDDGDALIARTQDIYDQAAPSAASMAALLCLRLSEIADERYLSPA
ERQLDVLAPTALENAFGLGQTVCVLDRLTRGAVTVVVVGEAGSASAAELTREAFKVYLPN
RAIVLVDPARPESAAAVEVVAEGKPARPDGAVAYACRGRTCSAPVTTAADLKALLA
Download sequence
Identical sequences A9G6F1
448385.sce2525 gi|162450797|ref|YP_001613164.1| WP_012235157.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]