SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162451171|ref|YP_001613538.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162451171|ref|YP_001613538.1|
Domain Number 1 Region: 80-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.34e-34
Family Glutathione peroxidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162451171|ref|YP_001613538.1|
Sequence length 244
Comment lipoprotein [Sorangium cellulosum So ce56]
Sequence
MVSTEPTRHASGALPPAEPTGQSFPSDRGDAGRPRRGGLVGTPVFWAAILALVGLVALVA
IGVAGRALHGRAAETPAIRIPLPAFELTDQRGARFGLEQLRGRVWIADFIFTTCPTVCPK
LTQRMSEIERRGRDLGDALHLVTFTVDPENDTPAVLAAYAASQRLPLERWTFLTGPLDQI
ESTVLDGFKIAMGKKESSPGLFSIFHGERLVLVDQQGVIRGYYEANDDGLDAILRDAGAL
VKSR
Download sequence
Identical sequences A9GEU6
WP_012235530.1.90317 448385.sce2899 gi|162451171|ref|YP_001613538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]