SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162451230|ref|YP_001613597.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162451230|ref|YP_001613597.1|
Domain Number 1 Region: 265-434
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.56e-39
Family Thioltransferase 0.081
Further Details:      
 
Domain Number 2 Region: 473-642
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-39
Family DsbC/DsbG C-terminal domain-like 0.062
Further Details:      
 
Domain Number 3 Region: 48-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.54e-38
Family DsbA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162451230|ref|YP_001613597.1|
Sequence length 675
Comment hypothetical protein sce2958 [Sorangium cellulosum So ce56]
Sequence
MNKGTAIVGFLLCFIAGMGLMWSIDRSAGSRGHEISAVHEDGQPWTDEDAAVPVSSKDPM
WGTRAAPVTMVVFSDFECPFCTKVETTINQLKDKYGPEKLRIIWKNNPLPFHKNARPAAL
AAETVFRLGGSKAFWKFHELAFQNQKSLTPENFEKWAGDAGVDRAKFKAAFDRQEYMAKI
DADMAVGKSSGVTGTPASIINGVFLSGAQPIDKFTSVIDEQLKAAQAAVAAGTKPDKVYA
KLAAENKAKAPPQKDRERPQEDDKTVWKVPVGDAPAKGPATALVTIVEWSDFQCPFCSKV
VPTIDEILTTYGDKVRFVWKNNPLPFHQRAEPAAELAMEARAQKGEKGFWDAYYLLWKNQ
QKLNDEDLLGYAKELGLDVEKVKAAIATKKFGASIAADQELADDLQASGTPHFFINGRRL
VGAQPIDKFKTIIDEEIKKSEALLAKGVAAKDLYAEIIKDGKEPPPPERKEVSAPAPNSP
WKGGERAKVVMQVFSDFECPFCKRVEDTVSQISKTYGDKLKIVWRHRPLPMHKNAPLASE
AAQEAYTQKGNAGFWAYHEVLFKNQGQPDAFSRASLEKYAEEQGLDMTKFKKALDANTHK
AFVDSENSVADKAGISGTPAFVVNGYFISGAQPFSKFKKLIDKAMKEAGETAPAGLPAKR
PAPATQPAAAPAAPK
Download sequence
Identical sequences A9GF88
WP_012235589.1.90317 gi|162451230|ref|YP_001613597.1| 448385.sce2958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]