SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162451730|ref|YP_001614097.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162451730|ref|YP_001614097.1|
Domain Number 1 Region: 28-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-16
Family Thioltransferase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162451730|ref|YP_001614097.1|
Sequence length 121
Comment hypothetical protein sce3457 [Sorangium cellulosum So ce56]
Sequence
MAERPTLAPEKISDTVKSQIAGFHRSIVDEVAAAVSRDRVVVVGMAQNPFVKKARQLLDG
EGVKYTYLEYGSYLSMWKERLAIKLWAGFPTFPMVFVGGVLEGGYAELVKLRDQGKLKGS
P
Download sequence
Identical sequences A9GNQ4
WP_012236087.1.90317 gi|162451730|ref|YP_001614097.1| 448385.sce3457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]