SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162451875|ref|YP_001614242.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162451875|ref|YP_001614242.1|
Domain Number 1 Region: 396-525
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000418
Family Bactericidal permeability-increasing protein, BPI 0.012
Further Details:      
 
Weak hits

Sequence:  gi|162451875|ref|YP_001614242.1|
Domain Number - Region: 182-266
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0575
Family Bactericidal permeability-increasing protein, BPI 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162451875|ref|YP_001614242.1|
Sequence length 1377
Comment hypothetical protein sce3602 [Sorangium cellulosum So ce56]
Sequence
MPRVIKHFSAILVLLVIAGCAASGGGCAGCGMTPLPAGFKPADRIENAGAARLTQSGVEF
LEHNLGVLGRALLGGGDGGVITFSIPRSTGSVALGAIDYALCPDGADPSATPPECIAEID
AGRAALQIQPRTPHNLLVRGELPVRLQSLPIFLDGGILGESTQYVTLNGNDACPPDAQTF
TNIDVEVELSIEIDVNPQHSRQGYSRVKVVRLSIDEDQLVSNLHLDCGGTWVGDALDFVK
PIITSFMGSMSNALKAQLDQQLCLKAEPTQDPACPDGTNDIGGVCRYGTHASDECASILL
GVEGHIDLGRLLASVSPGTQGGFDLLLAGGGTSERDDGSDLAWGDLNPVGNGLTLGLYGG
AEPVPTSKCVPLSNMALPAGIPIPDELVANTVSDWPADLPGPHVGLAISERFANYAMNGL
YNSGLLCLGISTETVPLLNSGTLGLLAPSARDLALQRESQQVAVVIRPQVPPRLTFGNGT
NGSDDPLIRIQLDRASFDFYVWSLDRFIRFMTATFDVDVPMNLSVTPEGLTPVIEALRVE
NGEVTNSGLLRENPDNIAKALGGLLGGQLGQLIGGGIPAIDLDGPLSALGLSLVIPESAE
GAGSPGLRKLTKGQDNYLGIFAAFGTTAQQRSARSDTRAELSRKEVRAEGLRLPTMTRDN
GPTARLVMSSPLDDGTRAVEYSYRIDSGVWRPFTRERIVELRDDWLRLPGRHVISVRSRI
AGAPLSLDPTPATVEMVVDVDPPVISVGAAVDGRAPLEVRDRVSDAARAKVRVRLDDGAW
SPWSTAAETTSVDVGDAVDIEVEAVDEEGNLGTARQAILRGRVPVDPSAGCSCVVAGGAG
ETPSGVRWLGLAVAAAALRLARRGDRGSSPRRPARRGARGLKGALAGVAVMALLGSHAGC
SCSEEPEQVEPGCVAPDCMTLEHGLIGAYTSVAVAADKRTVWVAGYAEADWRNAFAWGDL
VVGTWDGEAVAWEAIDGVPAEPPVDPARFDVSGFRGGQTEPGDDVGLWTSIAVGPDGEPA
VAYYDRTNRALKFAQRQGGTWAVSFVQQAPSSDIGRYAKLLFVKGSPVIAYLAMEPGEGG
AVTSSVRIATGESATPGEGAWRFEDVAKDEATPCRAFLCGAGAKCIRSTGRCATALAAGD
CEPGCASGQACIDDGGSPACAATSDGNRIETYPEAIGDYIAMAPDNAGGFGLAFYDRIHG
DVVIASRSMGAWETRIVDGAAPDGTDTGDVGMGTSLFIDRAGDWHLAYADGRSEGLRYAR
VKGGTEVEPSEVADDGLGIEGVPFEDGQHLIGDDANVFVTAAGEVRISYQDATSGTLRLA
IGTKSGDGHSWLIQEIEQEGFAGAFSRIVEVDGRLLIANWWRVGGQTTKGDVALVTP
Download sequence
Identical sequences A9GSE4
448385.sce3602 gi|162451875|ref|YP_001614242.1| WP_012236232.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]