SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162452266|ref|YP_001614633.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162452266|ref|YP_001614633.1|
Domain Number 1 Region: 276-391
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.32e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 193-278
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.41e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162452266|ref|YP_001614633.1|
Sequence length 395
Comment hypothetical protein sce3993 [Sorangium cellulosum So ce56]
Sequence
MAGTPQKGGFRNERTRDPQAVERLRGRGDVRRGPCCEVDPPAGFRHDVPRLRDAGGDRRP
ERRRSAGRSVQQRASDGELPAPRPDDPAAREPGALLEGPGRLLRRGEPDHLLSAPGSSRP
SSSGGTAPLLYPRGRARACRQGARETGRVRRAARRVRRAAGDVAGSAAPGARRRSRHAEV
AIGARAPLALLKRMMKLYFSPGACSLSPHIALREAGLQFELEQVHLGTKKTRSGADFTLI
NPKGYVPALEIEGGEVLTEGPVIVQYIADRRPESGLAPPAGTLDRYRLQEWLSFISTELH
KQFSPLFKPRVPDEQKNAARALLGRRFAHVAHRLEGATYLLGERFTVADAYLYTVTTWTR
FAGVDLGGWPVLGRYRERVGARPAVQAAIEAERRR
Download sequence
Identical sequences A9EQL0
gi|162452266|ref|YP_001614633.1| 448385.sce3993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]