SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162452347|ref|YP_001614714.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162452347|ref|YP_001614714.1|
Domain Number 1 Region: 1156-1437
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.34e-59
Family Complement components 0.0031
Further Details:      
 
Domain Number 2 Region: 1549-1636
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000837
Family Alpha-macroglobulin receptor domain 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|162452347|ref|YP_001614714.1|
Domain Number - Region: 484-556
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000235
Family Invasin/intimin cell-adhesion fragments 0.003
Further Details:      
 
Domain Number - Region: 256-346
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0267
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 
Domain Number - Region: 174-243
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0392
Family Invasin/intimin cell-adhesion fragments 0.013
Further Details:      
 
Domain Number - Region: 1006-1082
Classification Level Classification E-value
Superfamily E set domains 0.042
Family SVA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162452347|ref|YP_001614714.1|
Sequence length 1648
Comment alpha-2-macroglobulin [Sorangium cellulosum So ce56]
Sequence
MRSRFDALRRRWSSPHLLAALALASAFAAGCSSDEAPPTTLGRPDQPRNGTLEIDEARLL
GVIDGSDLRLQIPVRNLTAGATSGHLRVTLVDLGADREQGTTEVDLAIAGGTATTAEARL
PAPAVSAQPGLARYLVRVDDGSDEGLLVTRSLLRVIPPYDVQLEGPARVVRGRTASYRVR
ATDAFSHQPVPNVGVELAVGEGARPLRGTTDALGAAVFEVEPGALGAHPVSAQALGFGVN
AALTANITVEGPGPKLLLTTDKPLYKPGQTIHLRALALERGNNAPLVREAITFEVEDGKG
NKIFKKPIETDAYGVAATTFRIGSIVNTGEFKVRLVSGETTTEKVVTVGQYALPKFEVAV
RTDRPWYTAGDTLTGTIDARYFFGKNVAGGSVTIEAASLDVGQTTFQRIMGELDAEGHYG
FSLALPPSLAGLPLEQGDAAVTLTVTVADTAGQEVTKAIPVKVAADAASIVLVPEARELV
PGIPNTLLLFVTDPLGAPLADTEAVITAPDSTQLTARTDAFGQAVVSFTPPVAAADGAFE
VRATVGERAVTRKFSFGTQTGGEHLLVRTDRAVYETGETVEVTIESSEEAGSVYVDWLND
GQAVDMRSLELEGGRAHFSMPVDAGLLGSNRVEAYLVDDDGNLVRSGRTVFARGDSALSV
EVQADKPLYAPGETATLRLSVKDDAGNPKVAALGVQVVDQAVFALVDAQPGLLRTYFELE
DEFAKPSYEIHGPAANLQDLLFNATASEDPEQAEAAQVKTQASLAALAGTSLTGLQARTW
PAVLAKVPEELAQFNERQKGVMKPWLAEATAAAAQELKALGCDSTQFSCNGQGVYVELLG
NRVAERLRAFDVWGNAYRVASSWSGLTLQSSGPDEVEQSQDDATFAFTFSDLGIQVPPQE
WNEGGIPGDADGGWANGAASASSGGTGAGGGSAGNPTPDPGGGNGGGPRVRREFPETLYV
NPSVITSPDGTATLSIPLADSITEWRLSALANSTDGKLGGIQSGFKVFQDFFVDVSFPAT
LTRGDEVEFPIAVYNYLETPQTVDLSLEPGSWYTPLGATSTTVSLAAGEVRGVRFPVKVN
TVGVNSLTVTARGSAGADAVARTVRVVPDGKPFAESASGMLATGSADHALSFPADAVPGS
NQLYLEIYPAFLSQVVSGMDSMLQVPNGCFEQTTSTTWPNVLVTQYMKQTGQITPEIQMK
AESLISAGYQRLLTFEHSGGGFSWFGEQDGHPYLSVTAFGVMEFADMIKVHTVDEAMLAR
TVNWLAGQQKADGTWEGDQTEFFSFHTGTLRNSAFVLWALASAGYTGPEVGTGLAYLGRS
LKPATDDLYTLAIAANALAVADPSGALTDQVLDALDQRKTAEGDAFYWDDGGTQTSFYES
GSDARVTTTALAAHALLSAGAHRPSADGGVKFLTQSKDPNGNFGSTQATIWSLRTLLLAA
SKGTEGATGTVTVAVDGEAAGTVSLRADQADVMTTVDLTHLATAGAHDVSIAFSGEGKLS
YNLVSRHNLPWSAVPSDAGGPLAVSVAYDKTQLYVDDIVTASLSVQNRTDSVQSMVLVTV
GLPPGFQLLTEDLQEYIAAGQLSRFEITGKQLILYVKEIPAGRAATFAYRLQATMPVRAE
DGGAEVHPYYQPEQQSFSGAQLLEVAGE
Download sequence
Identical sequences A9EVK9
448385.sce4071 gi|162452347|ref|YP_001614714.1| WP_012236704.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]