SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162452366|ref|YP_001614733.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162452366|ref|YP_001614733.1|
Domain Number 1 Region: 276-419
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.73e-33
Family Adenylyl and guanylyl cyclase catalytic domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|162452366|ref|YP_001614733.1|
Domain Number - Region: 71-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.028
Family Thioltransferase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162452366|ref|YP_001614733.1|
Sequence length 458
Comment hypothetical protein sce4090 [Sorangium cellulosum So ce56]
Sequence
MDTHRLKTLIERLRQQHPANAGEIDAVERWLHDAPLIRRYRINPHVVAADTALDPHAVIR
VLLHGTQTGLFDMHWDVHCGHCNMLAEAIDDLATAAAVSFCPMCEYSFDVDISARVEVTF
SLGRSIEDLGFPPVCQPPSALHPRYGMTAALGETAAATEVLTAGRYRYFCPLTRAKGILR
VEGEPTDEVQAAAISQLAGPHYDVTELEVRPGPLRIALTNVGWPQCGFIVHHDVLKDELD
PASLPRRLSGLELLHVPEYRRYFGGMVLSARERLTVRSVLVVFTDLCGSTRLYERIGDAP
AYNLVRDHFDIVIGAVEAQGGAVVKTIGDAVMATFLDERSAVTALSAAMRGMLGRNAGRP
EGERLVLRAGMHRGPALLVNLNQRLDYFGRTVNTAARLLGVSAGGELTVSAPLAADAELA
GLLTAEGWTPPRASHVDLKGIEGTRTVHSAGFPGMAAR
Download sequence
Identical sequences A9EVS7
WP_012236723.1.90317 448385.sce4090 gi|162452366|ref|YP_001614733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]