SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162452543|ref|YP_001614910.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162452543|ref|YP_001614910.1|
Domain Number 1 Region: 232-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000069
Family Thioltransferase 0.034
Further Details:      
 
Weak hits

Sequence:  gi|162452543|ref|YP_001614910.1|
Domain Number - Region: 88-165
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.0248
Family Cytochrome c oxidase subunit I-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162452543|ref|YP_001614910.1|
Sequence length 358
Comment hypothetical protein sce4267 [Sorangium cellulosum So ce56]
Sequence
MSHAFGPTQPLPNRDANEPPAALRDVQTGALPCESEPPAGAPPCDTVAARGRVALAPAAA
QPSRAQAARLIIQDPYLTPPPPPERRQLSTLAVSSLVAALFGPLGAIAAIAFGWAARREI
EQDPAVRRGYALASVGLALGVLLTLCWSSAIGFGVWMWSTHHSGETASALPEGEASPEPA
STASPSMPLPEARPPAVQPSGSVPQHTTHRRIGGVSIVDIGVDVSVLSEELAKQRAEAYA
QGEKVLVMTTSDPCEPCRGVDRSLGDPLMQTALRSVRLVRVDIDLFKEDLDQIKVPRRLY
PGFFLLSPDLSPQDGINGGEWDDDIARNIAPVLGAFVRGQYTTRRQPWNPLPGSGMRL
Download sequence
Identical sequences A9F1X6
gi|162452543|ref|YP_001614910.1| 448385.sce4267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]