SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162452786|ref|YP_001615152.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162452786|ref|YP_001615152.1|
Domain Number 1 Region: 52-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.26e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 178-246
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000396
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162452786|ref|YP_001615152.1|
Sequence length 267
Comment glutathione S-transferase [Sorangium cellulosum So ce56]
Sequence
MARRGLERLQGGERRQRRRVIPRGGAGHENFSCTMENIRSLVQARRGIPGVMKLYRLRYS
PFARKVQMLLDLLGRPYELVEVPYDDRDELARVTGGYIYVPVLVGDDGRVTVESRRICEL
LLEDPAARRLTLDVLEGPVWAYADFCDGPLEDVLFRVASPRIRDAWERPGQRALYTLIKE
RKFGAGCIEQWERDTPALLERAKTLLAPTVRTLKRSPFLFGEAPSLADAALYGNLAMLFE
ADRALPGALAAELPGYISRLERLIPSR
Download sequence
Identical sequences A9F8M9
448385.sce4509 WP_012237142.1.90317 gi|162452786|ref|YP_001615152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]