SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162453034|ref|YP_001615401.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162453034|ref|YP_001615401.1|
Domain Number 1 Region: 122-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.62e-22
Family PDI-like 0.065
Further Details:      
 
Domain Number 2 Region: 249-291,409-511
Classification Level Classification E-value
Superfamily TPR-like 0.0000000024
Family BTAD-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162453034|ref|YP_001615401.1|
Sequence length 555
Comment hypothetical protein sce4758 [Sorangium cellulosum So ce56]
Sequence
MPRSCRTDPRNRSLRRDCTSFAAVGERLIDARRRPPATPRSGPGAALGPGAALACRSEGE
LAAVRLPCLAVRAPALLPALVSAAALAACAAEPPPRAPAPPAAPPSPPAAAPSPAAGPEP
AAARPPLEFIHDDVPRAREKARAEGKALFVDAWAPWCHTCLSMKHYVLTDPSLRPFADRV
VFADVDTDRPESAPFLERHEVTVWPTFFVLEPAGGEVIGLWRGAASVEELRELIREALLA
MDSQAASALPADDPNRLLVEAKRAHSAGDHAAAVSAYRRALARGGEAWPRRSEALLGLLS
ALYRTKDAAACAELGSAHVGEVKGAALPADFASVLLSCAAALPGGKAQRAAREAAVARLR
SIVASPPADASADDRADAWGLLAEGLEALGDAGGARAASESKLAVLERAAKEAKTPEAAA
AYDYGRAMAYIALGRGEEAVAMLSQREAQMPASYEPPARLAQVLHAMGREAEALAAVERA
IGRAYGPRRLRYLKLRAEIQQRLGRGAEQIATLREEVAGYEALPKGHASQAALDDARRRL
AEAKKAQRGGGVKKR
Download sequence
Identical sequences A9FET7
gi|162453034|ref|YP_001615401.1| 448385.sce4758 WP_012237390.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]