SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162453285|ref|YP_001615652.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162453285|ref|YP_001615652.1|
Domain Number 1 Region: 39-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.93e-47
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162453285|ref|YP_001615652.1|
Sequence length 259
Comment bacterioferritin comigratory protein [Sorangium cellulosum So ce56]
Sequence
MKRRFPIAVVFVVLAVVFAFASLLGCGAAERPDGGQGLIPVGAAAPDVFAADQHGAIQRL
SDQRGRAVVVYFYPKDGTPGCTEEACAFRDAWDRFKQANVQVFGVSSDTRESHEKFATEN
KLPFPILVDTDHAWATAFGVPMRLGATARVTFLVDPDGKIAKVYPDVDPGVHADEVLKDA
AQLTGAALPVAPAASGSAAPAAPDTAAPAATGAPPAAAPAGAAEPATAAPVATGTMLPPA
APAAPPAKGPPAKGSPARR
Download sequence
Identical sequences A9FL26
448385.sce5009 WP_012237641.1.90317 gi|162453285|ref|YP_001615652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]