SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162453366|ref|YP_001615733.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162453366|ref|YP_001615733.1|
Domain Number 1 Region: 11-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000375
Family Glutathione S-transferase (GST), N-terminal domain 0.048
Further Details:      
 
Domain Number 2 Region: 98-121,168-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000824
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162453366|ref|YP_001615733.1|
Sequence length 280
Comment glutathione S-transferase [Sorangium cellulosum So ce56]
Sequence
MSDPGAGALLRLITIPWSHFCEKARWALDRAGARYREDAYLPLAHALPSLRAGGRRSVPV
LVSPAGVLGDSTDILRYADTLVPPERALFFQGSREPDAGRAEVEALEQRFDADLGPAIRR
VAYFHLLPDAEGAFAFMGGSFRSLEGAGAAPPWWFGRGTFRAYYPVARAVMKRVMRIDPA
SAERSRGKLRAVFDAVNERLRDGRPYLVGDRFSAADLTFAALAAPLLAPEHHPSPLPPSS
ELPSELRALAEGLRGEPAGAFALRMYREHRRARPERSAGG
Download sequence
Identical sequences A9FR46
WP_012237721.1.90317 448385.sce5090 gi|162453366|ref|YP_001615733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]