SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162453673|ref|YP_001616040.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162453673|ref|YP_001616040.1|
Domain Number 1 Region: 76-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-29
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162453673|ref|YP_001616040.1|
Sequence length 207
Comment hypothetical protein sce5397 [Sorangium cellulosum So ce56]
Sequence
MKLYEFAPTRSIRVRWALQELGVDFETVQVNLRAGENRRPEFLKLNPAGKLPVLVDGDLV
LTESVAIVLYLAEKYPDKGLLPADPRERAKVNQWLLFAATELEQPLWRIARHKFLYPEDK
RQPGDIPVAREDFKAMAAVLEKHMDQRQFVVGDSVTVADLVMAYTLDWADEAHLLDDFPQ
LRAYMDRMYARPHAAPRIAQAFASLKG
Download sequence
Identical sequences A9FXX8
gi|162453673|ref|YP_001616040.1| 448385.sce5397 WP_012238028.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]