SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162454000|ref|YP_001616367.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162454000|ref|YP_001616367.1|
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.86e-40
Family Glutathione peroxidase-like 0.00000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162454000|ref|YP_001616367.1|
Sequence length 164
Comment thiol peroxidase [Sorangium cellulosum So ce56]
Sequence
MAETKFKGSPIHTAGELPSVGATAPDFTLVKTDLSERKLSSYSGKKILNIFPSVDTPVCA
RSVRTFHERAEKLPGVTVLNISADLPFAHTRFCASEGISNAEGLSTFRGDFGQKYGVTLV
DGPLAGLLARSVLVLDEQNKVLHVELVPEIAQEPDYDAALAKVQ
Download sequence
Identical sequences A9G7P2
gi|162454000|ref|YP_001616367.1| 448385.sce5724 WP_012238352.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]