SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162454396|ref|YP_001616763.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162454396|ref|YP_001616763.1|
Domain Number 1 Region: 168-266,303-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000202
Family Glutathione peroxidase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162454396|ref|YP_001616763.1|
Sequence length 381
Comment hypothetical protein sce6117 [Sorangium cellulosum So ce56]
Sequence
MSTVNVDTTSPSPRARAVILGAVATLVATAIHHVYGGVRYATPWRLHGAAVALALCVPIA
LAYAGYRRSPGTRAGRIAGGSLAALALAFPVTSIGLFEGAYNHLAKNVLFFAGAPRDLLL
RMFPPPTYELPSDAFFEITGVGQIVPAAITAIAALGLIGDLRRRVTRLAPGTVLGARELV
GVHGERIRIPDPTRIVHLQLRRFAGCPVCNLHLRSITVRHDEIAAAGIREVVVFHSSADE
LRLHAGGLPFAVVPDPEKRLYAELGAEPSLLSVFDPRVWPIIVHSVARSAIAILRGRERP
PALIPTGGRFGLPADFLVAPDGRVLASKYGEHAGDQWSVDEVLALTRAPAVSSVRAAAER
GAASVLDGGSASRLPTRCSPG
Download sequence
Identical sequences A9GG62
gi|162454396|ref|YP_001616763.1| 448385.sce6117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]