SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162454479|ref|YP_001616847.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162454479|ref|YP_001616847.1|
Domain Number 1 Region: 283-423
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000988
Family DsbC/DsbG C-terminal domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162454479|ref|YP_001616847.1|
Sequence length 448
Comment hypothetical protein sce6200 [Sorangium cellulosum So ce56]
Sequence
MSGSRGPRGPAALALSGSLLGLAFSASSTFDYIRHLDRQVHDLHCSFVPGLGAQAGADTA
CRVAMYSPYSALFRESFWGGIPISLFALGAFAFFAAFALYVLLSAQHAPRRAAHFLFVAG
LTPLAVSLLMATISAMRLGVFCKTCVGMYISSALLAAGGVWAFLEDRRAARAAAWSSAAP
RAPSSAGAAGVGPTVPGAPLGVDGPGGVAAAPAAPPRRVGSLLLLPGWLVALGVCTVTPA
LLYASALPSYASYMTGCGKLEKPTEPSGALLHVTRPGAVQPATLFVDPLCPTCKAFHQRL
VSEGVWEKLDATVVLFPLDSECNWMLDRPVHPGACLLSKAILCSDHRAMDVLEWAYENQE
TLLEGAKAGAGIANVQAAIRQRWPGLDACMDSKETALRLNRMLRYIVDNKLPVSTPQMFL
GTTRLCDEDTDIGMSYAIRQLAPALRTK
Download sequence
Identical sequences A9GGU2
WP_012238820.1.90317 448385.sce6200 gi|162454479|ref|YP_001616847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]