SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162454482|ref|YP_001616849.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162454482|ref|YP_001616849.1|
Domain Number 1 Region: 108-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000497
Family Glutathione peroxidase-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162454482|ref|YP_001616849.1|
Sequence length 258
Comment Thiol-disulfide oxidoreductase [Sorangium cellulosum So ce56]
Sequence
MYGGGHQPQRVRLVGGLSAVSPARKSGALRGAFAALAVAAGLAGGCDADKKADLPPPPTP
GQGRSNAVTAPGAAAPASARAPASATAEAAPAAPRLLCAGQSPRPAPSSGGLTAVAASGA
EKLPANIGFGVGKWVWVNFWAAWCKPCLEEMPRLLGWQQKLRAAGVLVDLAFVSIDDDER
QLSRFLEAQPGTGVRASYWLPDGPQRAGWLRALGVKETTELPIHAIAAPSGQVTCVIQGA
VEDSDYPTIAALLGSKKP
Download sequence
Identical sequences A9GGU9
WP_012238823.1.90317 448385.sce6202 gi|162454482|ref|YP_001616849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]