SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162454880|ref|YP_001617247.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162454880|ref|YP_001617247.1|
Domain Number 1 Region: 367-664
Classification Level Classification E-value
Superfamily NHL repeat 2.09e-18
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 126-179
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000127
Family TNF receptor-like 0.0042
Further Details:      
 
Domain Number 3 Region: 270-324
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000112
Family TNF receptor-like 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|162454880|ref|YP_001617247.1|
Domain Number - Region: 221-260
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0273
Family TNF receptor-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162454880|ref|YP_001617247.1|
Sequence length 730
Comment hypothetical protein sce6598 [Sorangium cellulosum So ce56]
Sequence
MHSNHDRQRPAHRQVSGFLIGGIVLLGCGSTVYDEDTRPSSGDTGHAEGTGATGGGTSSG
GTGASGGLGSDAGNTTAAAGNSGGSGGASGGATGEGGAGSGGATGEGGTPSDGGAGGAPD
DRPKICPDGSFDHDGDPSNPCKAWSRCPPGQYIAKEGTDTSDRQCVICGDGTFSTMQNVR
ACTPFTDCAPSTYVSQAGSTTADQRCSACPSASQPAPGSQCLPAGACLFSGACEPGTVQV
AAASGATPAECEVCDAGNYCAGGLTPQVRCDNGTWDHDGDPATCCSPWATCAAGTYVSRA
GSAATDRECTSCPSGSFSQSSNMDKCSPWTGCAPASSSWPQGGVATAGTATADAVCADPY
YKFGSEGSYAAFAVAVDGGGNVYVAGNTYGALGADGGESDAFVRKLDAHGAVVWTQRFGT
SSDDHAKGVAVDGSGNVYVAGTTGGGLEGASGGFGDAFVRKLDSSGATLWTRQLATWRSE
SANALAVDGQGNAYVAGTSYGGDQSTGEAFVTKIDTNGAPAWTQLFGGPDEDEAMAVAVD
GSGNTYVGGYTSGGVVADSDRGQRDAFVRKLDSSGATSWTRQFGSTENDFVFAARVDGSG
NLYVAGSTAGEVGGPNEGSQEAFVRKFDAGGATSWTHHAGNASYDYGFALAIDGKNDVYL
VGSTSSGEEDVYVRKLDASGAAQWTKEIGTPRSDTALAAAADADGNVYVAGYTGVFFTTS
DAFVLHVPAE
Download sequence
Identical sequences A9GPJ8
WP_012239216.1.90317 gi|162454880|ref|YP_001617247.1| 448385.sce6598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]