SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162456198|ref|YP_001618565.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162456198|ref|YP_001618565.1|
Domain Number 1 Region: 62-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000547
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162456198|ref|YP_001618565.1|
Sequence length 176
Comment hypothetical protein sce7915 [Sorangium cellulosum So ce56]
Sequence
MNGHRRKGSVCAGLFLCLAALLGCSREETSQPTAGSGATRPAALRAELEPAPEGGELAAL
VQQARERARREGRELVVYVGAPWCEPCTRFHDAVKAGQLDAVLPALRLLEFDLDSDRERL
AEAGYASEMIPLFVVPGEDGRGTPLRVEGSVKGERAVDEIVPRLAAILSRARASAR
Download sequence
Identical sequences A9FG43
448385.sce7915 gi|162456198|ref|YP_001618565.1| WP_012240524.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]