SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162456601|ref|YP_001618968.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162456601|ref|YP_001618968.1|
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.27e-17
Family Thioltransferase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162456601|ref|YP_001618968.1|
Sequence length 82
Comment hypothetical protein sce8318 [Sorangium cellulosum So ce56]
Sequence
MTTLTLFTRERCHLCEEAHAALERVRARLPFELAVVDLDREAGPEKRALYDWEVPVVELD
GRKIMKYRVDERRLERLLSGPE
Download sequence
Identical sequences A9FT37
448385.sce8318 WP_012240927.1.90317 gi|162456601|ref|YP_001618968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]