SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457100|ref|YP_001619467.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|162457100|ref|YP_001619467.1|
Domain Number - Region: 12-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00398
Family Glutathione S-transferase (GST), N-terminal domain 0.06
Further Details:      
 
Domain Number - Region: 162-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0162
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162457100|ref|YP_001619467.1|
Sequence length 214
Comment hypothetical protein sce8815 [Sorangium cellulosum So ce56]
Sequence
MSEALGELVKPVIVGRSSSHFTRVTRIFAVEMGVDHSLEVVRDLMSSNAADYGGNPALKM
PALRTSRGVWFGALNICRELSRQSKRAVRTVWPEDLDQPLLANAQELVVHAMATEVGLIM
AGAAGAGDGSAHHAKQRTSLMNTMSWLEDNASHALAALPSDRDLSYLEVALFCLVTHLEF
RRVLPTEPYPALNGFCREFAARASAGETTYRFDP
Download sequence
Identical sequences A9G573
448385.sce8815 gi|162457100|ref|YP_001619467.1| WP_012241426.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]