SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457290|ref|YP_001619657.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457290|ref|YP_001619657.1|
Domain Number 1 Region: 199-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.22e-25
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162457290|ref|YP_001619657.1|
Sequence length 403
Comment hypothetical protein sce9005 [Sorangium cellulosum So ce56]
Sequence
MPSSSELQAGRARFFVTLFRLALFVAIAASAALVVEYQNAGDPAFCGVTSGCFAVRISPY
SRFLGVPLPNLGLAAFTALLTASLLARARWHHAAIAAASAVGGLAAAVLLGLQSFVIGAF
CAWCIAVDLAAFAAAITSALVARQARRMPAGAFERAAQGGPLGVTVWGAAAAAAIGLPFL
WGSHPVIPPLPPELAALQEPGKITIVAFTDFECPFCRRLHPELSKIEEPYGDRVRHVRKM
VPLPNHPGALPAAKAYVCTPEDKREQAAALLYSASPSKLTDERVASVLSPLGLSAAELAA
CLAAPETQAAIDADVALYGRMEARGLPTTYVGRRLVVAYNPERIRDALRREAAGDDMSLP
LPWLFVALFGVAAVAVLAAGRDRSRGAADEGGAAPSSSSPERS
Download sequence
Identical sequences A9G9G0
gi|162457290|ref|YP_001619657.1| 448385.sce9005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]