SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457371|ref|YP_001619738.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457371|ref|YP_001619738.1|
Domain Number 1 Region: 16-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-37
Family Glutathione peroxidase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162457371|ref|YP_001619738.1|
Sequence length 181
Comment thioredoxin family protein [Sorangium cellulosum So ce56]
Sequence
MAEPQPNSGKILYPAVALLIALSALFGLVILPRLAPGASGMVGAEAPDVTLPVAANGEPG
ARMQLAELKGQPVILDFWATWCGPCAVQAPILDRIARRYEKKGLVVLGVNVDDPPQVASQ
YALKKGLSYPILIDDAKEASAHYGVDKLPSLVVIDRQGKVAAYLTGVVDEASLSEIVEAA
L
Download sequence
Identical sequences A9G9Y8
gi|162457371|ref|YP_001619738.1| 448385.sce9086 WP_012241697.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]