SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457390|ref|YP_001619757.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457390|ref|YP_001619757.1|
Domain Number 1 Region: 113-247
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.12e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162457390|ref|YP_001619757.1|
Sequence length 249
Comment hypothetical protein sce9105 [Sorangium cellulosum So ce56]
Sequence
MNAPTYELYYWPGIQGRGEFVRLALEDAGAPYVDVARLPAAKHGGVAAMQKLMKSHALAL
EPFAPPFLRSGDLVIAQVANILFYLGPRLGLAPDDEASRLGAHQLQLTITDLVAEVHDTH
HPISVELYYEDQKPEALRRSQAFLAERMPKFLGYFERVLERHGGRHVLGGAMSYVDLSLF
QVIAGLRYAFPHAMAAFAPRIPGLVALHDRVAERPRIAAYLASDRRIPFNEGGIFRHYPE
LDPAPSKRR
Download sequence
Identical sequences A9GCW2
448385.sce9105 gi|162457390|ref|YP_001619757.1| WP_012241713.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]