SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457511|ref|YP_001619878.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457511|ref|YP_001619878.1|
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-24
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162457511|ref|YP_001619878.1|
Sequence length 127
Comment hypothetical protein sce9225 [Sorangium cellulosum So ce56]
Sequence
MPQRKRYLFVCVNRRPDGVPKGSCAQRGAEGIHVQLKAALAERGLAKVEARACSASCLDV
CWAGPVIAVEPDGYFYGRVTPADVPEIVDALASGRRVERLVLPPEDFTEATAAPPLPAPP
RGAPPQA
Download sequence
Identical sequences A9GDT7
gi|162457511|ref|YP_001619878.1| 448385.sce9225 WP_012241833.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]