SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162450307|ref|YP_001612674.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162450307|ref|YP_001612674.1|
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-31
Family Thioltransferase 0.0024
Further Details:      
 
Domain Number 2 Region: 116-216
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.45e-24
Family Single-domain sulfurtransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162450307|ref|YP_001612674.1|
Sequence length 218
Comment thioredoxin [Sorangium cellulosum So ce56]
Sequence
MNSPAMAVPEINEQEFEREVLRSELPVLIDFTATWCGPCKTVAPEVDAIARELEGKAKVV
KVDIDRSKRIATTLRIQAVPTFMVFHRGRPVAAEQGVLNRKQLRELLDPFLPRAEGAIRA
AELAQLIREGQVVPVDTRETPAYGRAHIPGAVHIPIEEIEGRLAELHMLAGAPVLYCRSG
DKSKDVAAKLAEEGVPVAFLEGGFLSWEAEALPIQRPD
Download sequence
Identical sequences A9FQV8
448385.sce2035 gi|162450307|ref|YP_001612674.1| WP_012234670.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]