SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162455242|ref|YP_001617609.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162455242|ref|YP_001617609.1|
Domain Number 1 Region: 206-511
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.34e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00001
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.9e-26
Family PDI-like 0.00027
Further Details:      
 
Domain Number 3 Region: 105-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.15e-22
Family PDI-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162455242|ref|YP_001617609.1|
Sequence length 520
Comment alkyl hydroperoxide reductase subunit F [Sorangium cellulosum So ce56]
Sequence
MLEDSIKTQLRDVLGRLTRPVAVTAFVDDSQGSEEMRALLRDVASASSLVELHERREGAE
RTPSFGIHSPGEEPRVIFAGLPLGHELTSLILALLHVGGHPPRVSAEALEQIARIDGELR
FETYFSQSCQNCPDVVQALNLMAAKNPRVRHVAVDGALFQGEVEQRKIMAVPTVFLNGEP
FGQGRMEIEQILAKLDDGSAVKKRAEALDQRKPFDMLIVGGGPAGASAAIYAARKGLDTG
IVAERFGGQVMDTLAIENLISVVETDGPKLAAALEQHVRAYPVELLKHERVTSITPGSPF
ELRLASGATLRAKSVVLATGARWRDMNVPGEAEYRTKGVTYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGVVGHVTLLELAPALRADAVLVRKLKSMPNVEIVTRARTTEVVGDGQK
VVGLRWEHTETKEQHQIEIAGVFVQIGLLPNTGFIKGTVELNGLGEVVVNDRGQTSVPGL
FAAGDMTTTPFKQIVVALGDGAKAALGAFEYLIRATAPAE
Download sequence
Identical sequences A9GXQ7
448385.sce6960 WP_012239568.1.90317 gi|162455242|ref|YP_001617609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]