SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|162457164|ref|YP_001619531.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457164|ref|YP_001619531.1|
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000022
Family Glutathione S-transferase (GST), N-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 157-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000375
Family Glutathione S-transferase (GST), C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162457164|ref|YP_001619531.1|
Sequence length 242
Comment glutathione S-transferase [Sorangium cellulosum So ce56]
Sequence
MITLHSFGPMFGLPEASPYVTKTEVQLKLLGLPYTKERARPDQSPKGQLPFIDDGGARIA
DSHFIREHLEKKHGKDLDAGLDARQRAEAWAVERMIEHQLAAASGCARWLIPENFAKGPA
NFVNGAPEEARPKLREELLARVRENFRAMGIGRHSDAEIVELGARSLSALSALLGDEPYL
FGARPAGVDATAFAVLAGLLTPFFDSPLRRRAEGFANLTAYTARLMKEFYPDHPWEAPRP
GA
Download sequence
Identical sequences A9G5M8
WP_012241490.1.90317 gi|162457164|ref|YP_001619531.1| 448385.sce8879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]