SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159035850|ref|YP_001535103.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159035850|ref|YP_001535103.1|
Domain Number 1 Region: 1-423
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.86e-97
Family Gtf glycosyltransferase 0.0000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159035850|ref|YP_001535103.1|
Sequence length 427
Comment sterol 3-beta-glucosyltransferase [Salinispora arenicola CNS-205]
Sequence
MRVLVVTVGSRGDVQPYVALGKGLQAAGHHVTLATCARFRTVVTDQGLAYGQLSDDILQL
LDSTAGRAAMEDATGVFGSIKTNIKLARQANPINRKLLVDVWAAAQQAEPDVIVYHPKAL
AGPHVAEKLGVPVVLALPVPVSVPTGDFPLVGLPALPLGRWYNRLTYRLAGAGYRMYDGM
VNAFRRETLGLARTSGAALTTRLPDGRPIPVLHGISEHVLPRPADWPAHVHLTGYWFLDG
ADRWQPPPALVDFIEAGDPPVYVGFGSMAGRDPHRLTRVVGEALRLAGVRGIITTGWGGL
EMVEQSDTNWHLTQAPHDWLFPRVSAVVHHGGAGTTAAALRAGKPSVICPFILDQFVWGR
QVFALGAGSAPIPQRKLTAQRLAAAIREVTTNADVQGAAARLGRSLAAEDGVANAVARID
AVLDRAG
Download sequence
Identical sequences A8LXP6
gi|159035850|ref|YP_001535103.1| WP_012180423.1.102098 WP_012180423.1.18430 WP_012180423.1.23841 WP_012180423.1.25902 WP_012180423.1.26117 WP_012180423.1.29984 WP_012180423.1.30836 WP_012180423.1.33355 WP_012180423.1.35493 WP_012180423.1.3656 WP_012180423.1.51738 WP_012180423.1.68706 WP_012180423.1.69805 WP_012180423.1.76773 WP_012180423.1.77205 WP_012180423.1.79888 WP_012180423.1.806 WP_012180423.1.8104 WP_012180423.1.86246 WP_012180423.1.91622 WP_012180423.1.98445 391037.Sare_0177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]