SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159037924|ref|YP_001537177.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159037924|ref|YP_001537177.1|
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6.77e-88
Family Gtf glycosyltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159037924|ref|YP_001537177.1|
Sequence length 433
Comment glycosyl transferase family protein [Salinispora arenicola CNS-205]
Sequence
MLIATTPAPGHVVSMVDVAGELTRRGHEVRWYTGRAFQEQVEQAGARFEPMSEALDFGGR
SREEAFPSHAGLTGLASFKIGVRDIFYHTAPGQLDDLLRVLERFPADCILADDMCYGACF
ASERTGLPMAWLSNSIYILGSRDTAPLGLGLQPSSSPLGRARNALLRFLGDHVSMRDLRR
EADRTRASVNLPRLRTRAMENITRPPDLYLVSTVPSFEFSRSDLLPGTHFIGGLFGLPPE
RFEPPSWWQELDGDKPVVLITQGTTANDVDRLLVPAVRALAREDLLVVVTTGSDLDVDLL
RPLPGNVRLERFVSYHHLLPRVDVMLTNGGYNGVNAALAHGVPLVAAPATEENPDVAARI
AWSGAGVVLARRAVSEATLRNAVVTVLHDERYRQRAHVLSREHQRYDAPRRAAELIEAMA
ESQGRVPTGGPTQ
Download sequence
Identical sequences A8M270
391037.Sare_2328 gi|159037924|ref|YP_001537177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]