SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159038212|ref|YP_001537465.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159038212|ref|YP_001537465.1|
Domain Number 1 Region: 38-133
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000602
Family MioX-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159038212|ref|YP_001537465.1|
Sequence length 178
Comment metal dependent phosphohydrolase [Salinispora arenicola CNS-205]
Sequence
MHVVFDAESLLGFLAGLDGVYDAPPPLGDPVDLLAHGLQCAAVLRDERPDDLGLQLAGLV
HDIGHAVGDDPDHARVGADVVRPVLGARVADLVALHVPAKRYLASTEPDYELSEASRLSL
ARQGSAMTGEEQERFLAHPAAADAVTLRRADEAAKIVGRRVPGLDVWAPRLRTYASGV
Download sequence
Identical sequences A8M4Q6
gi|159038212|ref|YP_001537465.1| WP_012182775.1.14007 WP_012182775.1.18430 WP_012182775.1.33355 WP_012182775.1.69805 WP_012182775.1.77205 WP_012182775.1.8104 WP_012182775.1.91622 391037.Sare_2635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]