SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159038885|ref|YP_001538138.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159038885|ref|YP_001538138.1|
Domain Number 1 Region: 32-114
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000196
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159038885|ref|YP_001538138.1|
Sequence length 139
Comment hypothetical protein Sare_3344 [Salinispora arenicola CNS-205]
Sequence
MSDDRESPPLRVPDELLDYDRELFYTYNGKGFTGIGYADVPGHGLSEISYVDGAQEGPSR
DWYPSGQLKGESNYKANMLHGDMRDFRDDGSLISEKLYDHSVLVRSVTYDSQGNVVDHYE
ISESSPAFSQLRRLREQGG
Download sequence
Identical sequences A8LW38
391037.Sare_3344 gi|159038885|ref|YP_001538138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]