SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936837|ref|YP_001434633.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936837|ref|YP_001434633.1|
Domain Number 1 Region: 83-206
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.5e-19
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0088
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000153
Family Ferredoxin reductase FAD-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156936837|ref|YP_001434633.1|
Sequence length 220
Comment oxidoreductase FAD/NAD(P)-binding subunit [Ignicoccus hospitalis KIN4/I]
Sequence
MSFKVEEVLRSRKLAKGIYETFVSYHGEAPPPGTFFMVWVPGHEAIPLSVAGYRGDAVRF
IVEVRGRTTAALYTAHKVGLLGPLGRQAPVPSGKPLLVGGGVGIAPLLYMKELWGGELLF
GAKSAEKVPKIDGIDEVATEDGSLGFKGTVVDLLKLRPQKRDVYACGPPSMISSLKVLAK
EMGLKGYYSTEKMIKCGIGICGSCVLEGKLLCKEPWLRLG
Download sequence
Identical sequences A8A8H4
gi|156936837|ref|YP_001434633.1| 453591.Igni_0042 WP_011998078.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]