SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936883|ref|YP_001434679.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156936883|ref|YP_001434679.1|
Domain Number - Region: 24-68
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156936883|ref|YP_001434679.1|
Sequence length 70
Comment hypothetical protein Igni_0088 [Ignicoccus hospitalis KIN4/I]
Sequence
MKVFGPKGRGAEPPEVKAAELEEALKLIKEGKAKTAYKVFGRVILEVPLEEAERTIRAEL
EELKKRLEGG
Download sequence
Identical sequences A8A8M0
gi|156936883|ref|YP_001434679.1| WP_011998124.1.33635 453591.Igni_0088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]