SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936945|ref|YP_001434741.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936945|ref|YP_001434741.1|
Domain Number 1 Region: 13-97,171-250,500-741
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.45e-100
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00032
Further Details:      
 
Domain Number 2 Region: 760-932
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 7.85e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0034
Further Details:      
 
Domain Number 3 Region: 262-404,457-497
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 5.23e-29
Family ValRS/IleRS/LeuRS editing domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156936945|ref|YP_001434741.1|
Sequence length 1022
Comment leucyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence
MGDFVEDFVRYLKEIAAKWREEWERARLHEADVDPNRPKFYVTAAFPYPNSPMHLGHSRT
YSVTDAYARFKRMRGFNVLFPMGFHYTGTPIIAMSEKVKQGLQALRSLGEVKTILEEIWK
IKVERNLSIGEAIKEYLRGAGREDLMDKTDSIEYLVLFYKVFEIPVEDLEKLTEPLSMAN
YFASITEEGMKELGYMIDWRRKFTTVDPDFQKFITWQFLKLYDLGYVEKGTHPVAWDPVY
DTPVSQHDTKGDVEPEIEEYDVILFKLKDEDLYLPAATLRAETVFGVTNVWLNPEAEYEV
VEVDGKRWVLSKKAAYKIKFQKDEVKSLGPIDPKKLLKKMVINPATEEEVPVLPARFVDP
NVATGVVMSVPAHAPFDYVALKELEGDPEYSDIVKSIELVQVIRVPEEGLLVPQLVEKLG
IRDTSDKKKLEEATREVYSKEYRKGRMLESVLERVKGDERLRAALKAFLGNDPVPDAREK
TAKWLKLFGAGDVFYEIKNAPVYSRFGNEVVVKVLKDQWFLNYGDPQWKELARKALARMR
IIPENFLKEFEDTIDWLQKRACARTRGLGTPLPWDKRWIIESLSDSTIYMAFYTVVNILR
GASVEPEKLQPEVWDYIMLGKGNPKELEEKYGISAAVLEEARRSFDYWYPVDSRHSGKDL
IRNHLTFFIFNHAAIFPEDKWPRQIVVNGFVNLEGKKMSKSLGNIIPITVAIRSFAPDII
RLVLLHSAELGSDADFRTEMVSRAISNLREIKSIVEKVKDYNGPRPANLTMLDAWYLSSF
VKDVENVTNMMEDLKIREVTNVLYFILLNRTKEYLNALEAMGRGLDEVAKWVLRYTVERW
VKMMTPFTPFFAEEMWHELGFNTFVVTEPWPVKDEELVNPLAEAAKEYVEKVIEDIKEII
KVAKIEKPKKVRIEVASPEQVKMLKMAVEFVNSGKSLREFMAEATKVFGKKEAKSLRQAF
ERATSLSESMRSVIARGEFDEKAVLEEFKRLIEEEVGSEVEIRRYEGGKKRPEPLRPAIY
VE
Download sequence
Identical sequences A8A8T2
gi|156936945|ref|YP_001434741.1| WP_011998186.1.33635 453591.Igni_0150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]