SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156936981|ref|YP_001434777.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156936981|ref|YP_001434777.1|
Domain Number 1 Region: 18-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-35
Family Translational machinery components 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156936981|ref|YP_001434777.1|
Sequence length 148
Comment 30S ribosomal protein S9 [Ignicoccus hospitalis KIN4/I]
Sequence
MVDVKWAKEQQGKGGVRIVLATGKRKRAIARAIIYPGKGRVWINGVPVEIVKPEIKRWRI
LEPLLLAGEKVMKNIDIKVFVKGGGFMAQAEAARMAIARGLVKYTGSEELKALYEEHDRH
MLSGDPRRTEPEKWMRYSARRRKQKSYR
Download sequence
Identical sequences A8A8W8
WP_011998222.1.33635 453591.Igni_0186 gi|156936981|ref|YP_001434777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]