SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937005|ref|YP_001434801.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937005|ref|YP_001434801.1|
Domain Number 1 Region: 9-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.47e-45
Family Ribonuclease PH domain 1-like 0.00000299
Further Details:      
 
Domain Number 2 Region: 152-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.09e-23
Family Ribonuclease PH domain 2-like 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937005|ref|YP_001434801.1|
Sequence length 241
Comment ribosomal RNA-processing protein RRP41/SKI6 [Ignicoccus hospitalis KIN4/I]
Sequence
MMKEPPVPLIVDGKRHDGRGPADLRPLEMKVGVLYNADGSAWLRIGGTEVVAAVYGPREP
PMRGMVLPDRAVIRCRYHMAPFSTDERKNPAPSRREIELSKVIREALEATILTHLFPRTI
IDVFIEVIRADGGTRTAALTAASLALADAGIPMKGLVAGVAVGKVQGTLVLDIDELEDMY
GEADMPVAAIPSLNKIVLLQLNGVLEPREFPQALKLAWEGIKKIHAMQKKVLAEKYGGGE
A
Download sequence
Identical sequences A8A8Z2
gi|156937005|ref|YP_001434801.1| WP_011998246.1.33635 453591.Igni_0210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]