SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937109|ref|YP_001434905.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937109|ref|YP_001434905.1|
Domain Number 1 Region: 4-184,308-383
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-47
Family Bacterial dinuclear zinc exopeptidases 0.001
Further Details:      
 
Domain Number 2 Region: 184-300
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.89e-17
Family Bacterial exopeptidase dimerisation domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937109|ref|YP_001434905.1|
Sequence length 385
Comment acetylornithine deacetylase [Ignicoccus hospitalis KIN4/I]
Sequence
MSPQEVLDLLSQLISFDTVSPEGKQYEDLVHFLKGWLEERGVSAKVEYVDDEYRSSHCPQ
GPKPLLFAWVGEGEPLLEFNGHYDVVPPGDGWEGNPFEPKVVGEYLVGRGATDMKGGVAA
VAASLAELSNWKGNKVQAVFVPDEEVGGRCGTGYRVSKLKEKYEIPRRVVVAEPTDHNVW
IGHKGVVWLRVEVPGKQVHASTPWMGENAFVKASALVLELNRALTDKFSKRYSKYEYSPE
HPLTKFNAFNIGGVAYSTSNKENVVPGSFVFSVDVRVIPEEDEREVVEFVKEVIGDRAKV
EVKLLEPGILNENSELAKLINEVWGEPLKVHKAASDMRYYRGYDVVTWGPGDHRESHTPN
EKIKISEVVEFVGRYARLAKLLAGG
Download sequence
Identical sequences A8A996
gi|156937109|ref|YP_001434905.1| 453591.Igni_0315 WP_011998350.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]