SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937136|ref|YP_001434932.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937136|ref|YP_001434932.1|
Domain Number 1 Region: 295-413
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.000000000000173
Family Pseudouridine synthase II TruB 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937136|ref|YP_001434932.1|
Sequence length 427
Comment pseudouridylate synthase [Ignicoccus hospitalis KIN4/I]
Sequence
MRITEEALEVVKHYPLCDHCLGSLFARLGKGLGNEHRGEAIRRVIIMELDRMVREGEIKK
EEAEKIMSNFDSDEVEELAKNMGYSVRRRSCYVCGGKWRELVEEWSKKVVDALKEYEFDT
FLVGCSDCGGMVERQREIISAFRLPYAESVKNSLKREVGKRVKELLGKEPDFEDPHVVAI
MNLREDKVDLQIKPVFIYGIYKKKARNVSQSEWKYPYSVERAVRKALSPFGGEVVLHASG
REDVDVRALGTGRPFVAEVKRPKRRRLPVEGSEYEDELVWLRFERYVNRDWVQRVKGDES
KKEKVYLALVYVPEGVDEGDLRALEEFFEDVTIKQRTPKRVLHRRADVVRERKVYWVKAR
KLNDKSFEALIKAQGGLYIKELVSGDEGRTEPSFSSFLGKEATCASLDVVWVSLPQAELR
GGGEERG
Download sequence
Identical sequences A8A9C3
453591.Igni_0342 gi|156937136|ref|YP_001434932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]