SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937274|ref|YP_001435070.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937274|ref|YP_001435070.1|
Domain Number 1 Region: 698-789
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000968
Family Transglutaminase, two C-terminal domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937274|ref|YP_001435070.1|
Sequence length 944
Comment S-layer protein [Ignicoccus hospitalis KIN4/I]
Sequence
MVTLALVWAAEQKPLPPSPVYLVPERANLTLGHLGSVRLKVCNPSVTLISYATFQLATED
AAVTPSTFSVGDLRPRQCKEVILNVLPLKEVIRLSFVASAAYALGNSKALGATSGSLTLF
VRSPQLVMEPVEVSEVGGNVTLKFRNVGEAPFKGNIVITKPFFATLPLEVPPGGEGAAKA
EVPPTSPGKYEVEYKARYGKAELEGKGLMIVNPDPRVTFKLGKVIEVCFPRKQQFVIRLF
SRNAAPEPDSFKLELKGCTTLNYTVTPSSLPFTLSAVAKAGNLVLNDSVAMSYCDVSFNA
TELWAGVDNAVEVKVNCPLPVKGAVTLEPSPGAVDPPTLPLPGGAFVWSLPTSAKEAILK
VKMFGKTFAYNFNVKPFNPEFTVTFEPRSVVEGSVVRERMCVENAWNKAVKDVIVKVEVS
NWSSVATFDEVAPSQRVCLEGLVAVPWEVESLKAKVKIVAGSYSLEREEELEVKPNPEVA
VPAIELETKSLGVGKDVVTIRVKNVGRGYAKGAGLSLSSPYLLYPSYVYLGDMPPDSSKV
INATFFVPKDAKSVKLNAALSYCSGPLGGTCLPSQLKKEFEVPVRNYVPPNLVIAVKGEK
LRGGKSNAVYVELANSGGDEARSVTLSASSGDSDVTPSYFMLGDIPPGKKVTLKLFVTPP
ERAEEAELKLEARYTDPWGSSYSASFTKKFKVVPKPSPHVAVNMLTTILKTGKSVLRFEV
FNDGEVPAKGVELYVYSSGLPLSKSSFFIKELAPGQRALVEVPCSPNYPGTYSITVRVRY
GNVSDTFNYKISVATGPVLKVHDAATFPEELSPGSSGILGFSLANVGDQSAADVKISVEA
KGIRFTKKTLFLPRLSPGADVPAVFPFEVPAEAEPGTVPVTLKVSYLFQGEKYEKVFSAS
VIVKPRVKLSAESLGPEAMALALVVPIILLLLIKRRRSKTVVIE
Download sequence
Identical sequences A8A9R1
gi|156937274|ref|YP_001435070.1| 453591.Igni_0480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]