SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937512|ref|YP_001435308.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937512|ref|YP_001435308.1|
Domain Number 1 Region: 41-181
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000126
Family Bacterial dinuclear zinc exopeptidases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156937512|ref|YP_001435308.1|
Sequence length 188
Comment hypothetical protein Igni_0719 [Ignicoccus hospitalis KIN4/I]
Sequence
MFTQQPSITVSGADVDSVEEGDGGEIEVTWEKFEFSEILVGSLESPEAVVFIHYDSFEGG
SVDNGAAVAVALERLKELDLKKTLLAFTAPDEPSHEEPYWGFGFRFFEKEFKDVLESADV
IVTFDSVGLSSPLALRDKKSLEDLLPLEDKGLLEKAVGVTSDWDKLFEIYHSDLDTPDKV
DYSKTVEA
Download sequence
Identical sequences A8AAE9
gi|156937512|ref|YP_001435308.1| 453591.Igni_0719 WP_011998753.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]