SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937531|ref|YP_001435327.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937531|ref|YP_001435327.1|
Domain Number 1 Region: 138-451
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.16e-102
Family Leucine aminopeptidase, C-terminal domain 0.00000098
Further Details:      
 
Weak hits

Sequence:  gi|156937531|ref|YP_001435327.1|
Domain Number - Region: 71-120
Classification Level Classification E-value
Superfamily Macro domain-like 0.00135
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156937531|ref|YP_001435327.1|
Sequence length 453
Comment leucyl aminopeptidase [Ignicoccus hospitalis KIN4/I]
Sequence
MAERLLRLKLTDVPPERLVGVKVKIFKNKDDFVEFASPFYTVEEVKPNSVVKVKKDGEGY
VAAFCEDDFECATSLGKVLKQLRTSVVDLTNVEDPYPYITGIALTAWEFDKYKSEKREVE
IVFSTPNKEVAQEALRHAEAQMFARDLASEPPNVLNPKTFPERVMEKVKGLPIEVEVLDE
NDLKKEGLELLLAVGKGSDVPPRLLIMRYYGGGEKLAMVGKGVTFDAGGYNLKPANYMKN
MHADMSGAAAVAAATLYAAKLNLNVNLESYIPLAENLISGRAYKMEDIIRSYSGKYVHIG
NTDAEGRLILADALAYAKRSSPKVTFTLATLTGAQIIALGYDIAALYATHDEDAEKVEEA
SKRTKELVWRMPLYEKYKEELKHPSADLSNVGKGRGAGSIIGALFLKEFAPERWVYLDIA
GPAMAHEANAWWCSPYPTGWGARLMLATLKEYQ
Download sequence
Identical sequences A8AAG8
453591.Igni_0738 gi|156937531|ref|YP_001435327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]