SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156937547|ref|YP_001435343.1| from Ignicoccus hospitalis KIN4/I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156937547|ref|YP_001435343.1|
Domain Number 1 Region: 1-202
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.57e-61
Family Phosphate binding protein-like 0.0000513
Further Details:      
 
Domain Number 2 Region: 210-282
Classification Level Classification E-value
Superfamily GlnB-like 1.56e-18
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156937547|ref|YP_001435343.1|
Sequence length 283
Comment ATP phosphoribosyltransferase [Ignicoccus hospitalis KIN4/I]
Sequence
MRFVIPSKGRLKDATLELLERAGIRPSYLDSRALIVPSNKPNLDLVFARPEDIPWIVESG
AAEVGITGHDYVLESGRDVAEILDLNYGRSKLVLAVPRDSGIKRPEELPKGFRIATKFIN
IATDYFEKKGLDVKIVKVSGSAEVMPGIGAADGIIDVMSTGTTLKLHGLTPIDVILSSSA
RLIVRKDLLDDPRVETIKLMLESVLRASKKKLVMMNVPDEALDDVLKVLPAMSGPTISKV
KSEKPMWEVIAAVDEDEIADIIVKLKNAGAKDILVLNVERLIP
Download sequence
Identical sequences A8AAI4
gi|156937547|ref|YP_001435343.1| WP_012122900.1.33635 453591.Igni_0754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]